PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g018090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 536aa    MW: 58792.4 Da    PI: 5.2196
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g018090.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS441.84.7e-1351715311374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPilkfs 94 
                     lv++Ll+cAea++s++l+la+al++++  la ++  +m+++a+yf+eALa+r++r        l+ps+++ ++  s++l+    f+e++P+lkf+
  Csa14g018090.1 171 LVHVLLACAEAIQSENLTLAEALVKQIGFLAVSQIGAMRKVATYFAEALARRIYR--------LSPSQSPIDHsLSDTLQ--MHFYETCPYLKFA 255
                     689****************************************************........66777764441334433..35*********** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     h+taNqaIlea++g++rvH+iDf++sqGlQWpaL+qaLa Rp+gpp +R+Tg+g+p++++ + l+e+g +La++Ae+++v+fe++ +va++l+dl
  Csa14g018090.1 256 HFTANQAILEAFQGKKRVHVIDFSMSQGLQWPALMQALALRPGGPPVFRLTGIGPPAPDNFDYLHEVGCKLAHLAEAIHVEFEYRGFVANTLADL 350
                     *********************************************************************************************** PP

            GRAS 190 eleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     + ++L+++p   E++aVn+v++lh+ll +++++++    vL +v++++P++++vveqe++hns+ Fl+rf+e+l+yys+lfdsle        ++
  Csa14g018090.1 351 DASMLELRPseIESVAVNSVFELHKLLGRPGAIDK----VLGVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSTLFDSLEGV---PGGQD 438
                     ********98889**************99998888....*********************************************998...57899 PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +++++++lg++i+nvvac g +r+erhetl++Wr+r+++aGF++++l+++a kqa++ll+ ++ ++gyrvee++g+l+lgW++rpL+++SaW+
  Csa14g018090.1 439 KVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFSAAHLGSNAFKQASMLLALFNgGEGYRVEESDGCLMLGWHTRPLIATSAWK 531
                     99******************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011296.4E-422396No hitNo description
PfamPF120417.4E-342390IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098564.8145510IPR005202Transcription factor GRAS
PfamPF035141.6E-132171531IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MKRDHQDQDK MKEEEDDCNK GMDELLAVLG YKVRSSEMAD VAQKLEQLEV MMSNVQEHDL  60
SHLATETVHY NPAELYTWLD SMLSDLNPPP SSNSDYDLKA IPGDAILNHH FAVDSSSSSN  120
HGGGGGDVNA TSNKRLKCSN GTTVATVTTA AGDESTRPVV LVDSQENGVR LVHVLLACAE  180
AIQSENLTLA EALVKQIGFL AVSQIGAMRK VATYFAEALA RRIYRLSPSQ SPIDHSLSDT  240
LQMHFYETCP YLKFAHFTAN QAILEAFQGK KRVHVIDFSM SQGLQWPALM QALALRPGGP  300
PVFRLTGIGP PAPDNFDYLH EVGCKLAHLA EAIHVEFEYR GFVANTLADL DASMLELRPS  360
EIESVAVNSV FELHKLLGRP GAIDKVLGVV NQIKPEIFTV VEQESNHNSP VFLDRFTESL  420
HYYSTLFDSL EGVPGGQDKV MSEVYLGKQI CNVVACDGPD RVERHETLSQ WRNRFGSAGF  480
SAAHLGSNAF KQASMLLALF NGGEGYRVEE SDGCLMLGWH TRPLIATSAW KLATN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-511715314375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0069170.0AC006917.6 Genomic sequence for Arabidopsis thaliana BAC F10B6 from chromosome I, complete sequence.
GenBankAY0581940.0AY058194.1 Arabidopsis thaliana At1g14920/F10B6_15 mRNA, complete cds.
GenBankAY1420020.0AY142002.1 Arabidopsis thaliana At1g14920/F10B6_15 mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankGQ1773780.0GQ177378.1 Arabidopsis thaliana ecotype Ei-2 GAI gene, complete sequence.
GenBankGQ1773850.0GQ177385.1 Arabidopsis thaliana ecotype Mt-0 GAI gene, complete sequence.
GenBankGQ1773890.0GQ177389.1 Arabidopsis thaliana ecotype Wt-5 GAI gene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010459010.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ9LQT80.0GAI_ARATH; DELLA protein GAI
TrEMBLR0GWF20.0R0GWF2_9BRAS; Uncharacterized protein
STRINGAT1G14920.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein